DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and SR45

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001185014.1 Gene:SR45 / 838230 AraportID:AT1G16610 Length:425 Species:Arabidopsis thaliana


Alignment Length:150 Identity:33/150 - (22%)
Similarity:55/150 - (36%) Gaps:37/150 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQETL---------------------LKPPKKP--- 74
            |.|.|:.....|.|.|||:.:..:..|.....::                     ..||..|   
plant    21 SSRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVSSGSRSPPRRGKSPAGPARRGRSPPPPPSKG 85

  Fly    75 -----------TLVM-VCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGN-SLGTAHLSFKYRE 126
                       :||: |.:|...|::..:.|:|...|.|....:..||..| ..|..::.||.|.
plant    86 ASSPSKKAVQESLVLHVDSLSRNVNEAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARA 150

  Fly   127 EAFQIIEQFHGVRLDGRRLK 146
            :|.:......|.::||:.:|
plant   151 DAEKAQLYMDGAQIDGKVVK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 20/73 (27%)
SR45NP_001185014.1 RRM_RNPS1 100..172 CDD:409800 18/70 (26%)

Return to query results.
Submit another query.