DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and SC35

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:145 Identity:38/145 - (26%)
Similarity:67/145 - (46%) Gaps:15/145 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYD-RDGNSLGTAHLSFKYREEAFQIIEQFHGVRL 140
            ::|.|:.:....||:..||.:.|.|...|:..| |.|:|.|.|.:.:||::||.:.:|:..|..:
plant    18 LLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVV 82

  Fly   141 DGRRLKLHLVQNTRNFKRTDVDDLSLRMGSFKTRFLQNGTFKTRSLQNGFQKSRLFRNSSFKPR- 204
            |||.:.:...:...|.::..           |.|.::......||.....::||..|.|...|| 
plant    83 DGREITVQFAKYGPNAEKIS-----------KGRVVEPPPKSRRSRSRSPRRSRSPRRSRSPPRR 136

  Fly   205 --PFKKHNFKSRAFD 217
              |.:..:.:.|:.|
plant   137 RSPRRSRSPRRRSRD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 24/72 (33%)
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 24/71 (34%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.