DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and AT5G59950

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001190572.1 Gene:AT5G59950 / 836117 AraportID:AT5G59950 Length:245 Species:Arabidopsis thaliana


Alignment Length:182 Identity:53/182 - (29%)
Similarity:86/182 - (47%) Gaps:51/182 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQE 65
            ||..:.|||||:|           |||.:.:||:       |..|| ..|.:|.|..|::...::
plant     1 MSTGLDMSLDDMI-----------AKNRKSRGGA-------GPARG-TGSGSGPGPTRRNNPNRK 46

  Fly    66 TLLKPP----KKP----------------------------TLVMVCNLDYGVDDDDIMELFNQD 98
            :....|    |.|                            |.:.:.||||||.::||.|||.:.
plant    47 STRSAPYQSAKAPESTWGHDMFSDRSEDHRSGRSSAGIETGTKLYISNLDYGVMNEDIKELFAEV 111

  Fly    99 GVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLV 150
            |.:::..||:||.|.|.|||.:.:..|.:|...:::::.|:|||:.:|:.:|
plant   112 GELKRYTVHFDRSGRSKGTAEVVYSRRGDALAAVKKYNDVQLDGKPMKIEIV 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 52/181 (29%)
RRM_SF 75..149 CDD:302621 29/73 (40%)
AT5G59950NP_001190572.1 RRM_THOC4 88..162 CDD:410081 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - O PTHR19965
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.