DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and ALY4

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_198588.2 Gene:ALY4 / 833750 AraportID:AT5G37720 Length:288 Species:Arabidopsis thaliana


Alignment Length:214 Identity:63/214 - (29%)
Similarity:99/214 - (46%) Gaps:47/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSI---RKRNSEGGLRGIQRSRNGTGFI--RKS 60
            ||..:.|:||:|:|         ..|..|..|..|   |.|...||.||...:|.|...:  |.|
plant     1 MSGALNMTLDEIVK---------RGKTARSGGRGISRGRGRGRGGGGRGAGPARRGPLAVNARPS 56

  Fly    61 KFKQETLLKPPKK-------------------------PTLVMVCNLDYGVDDDDIMELFNQDGV 100
            .|   |:.||.::                         .|.:.|.|||.||.::||.|||::.|.
plant    57 SF---TINKPVRRVRSLPWQSGLFEDGLRAAGASGVEVGTRLHVTNLDQGVTNEDIRELFSEIGE 118

  Fly   101 VEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNTRNFK-----RTD 160
            ||:..:|||::|...|||.:.:..|.:|||.:::::.|.||||.::|.::....:.:     |.:
plant   119 VERYAIHYDKNGRPSGTAEVVYPRRSDAFQALKKYNNVLLDGRPMRLEILGGNNSSEAPLSGRVN 183

  Fly   161 VDDLSLRMGSFKTRFLQNG 179
            |:...|.....:|..:|.|
plant   184 VNVTGLNGRLKRTVVIQQG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 62/213 (29%)
RRM_SF 75..149 CDD:302621 32/73 (44%)
ALY4NP_198588.2 RRM_THOC4 93..167 CDD:410081 32/73 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.