DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and AT5G02530

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_195873.2 Gene:AT5G02530 / 831923 AraportID:AT5G02530 Length:292 Species:Arabidopsis thaliana


Alignment Length:269 Identity:72/269 - (26%)
Similarity:108/269 - (40%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQG-GSIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQ 64
            ||..:.||||||||.        |.|....:| |.|...|:.||..|   |.:.:|..|:...:.
plant     1 MSGGLDMSLDDIIKS--------NRKPTGSRGRGGIGGGNNTGGRGG---SGSNSGPSRRFANRV 54

  Fly    65 ETLLKPPKKP-------------------------------------------TLVMVCNLDYGV 86
            .....|..:|                                           |.:.:.||||||
plant    55 GARTAPYSRPIQQQQAHDAMWQNDVFATDASVAAAFGHHQTAVVGGGSSIETGTKLYISNLDYGV 119

  Fly    87 DDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQ 151
            .::||.|||::.|.:::..:||||.|.|.|||.:.|..|.:|...:::::.|:|||:.:|:.:|.
plant   120 SNEDIKELFSEVGDLKRYGIHYDRSGRSKGTAEVVFSRRGDALAAVKRYNNVQLDGKLMKIEIVG 184

  Fly   152 NTRNFKRTDVDDLSLR---------MGSFKTRFLQNGTFKTRSLQNGFQKSRLFRNSSFKPRP-- 205
            .  |.....:..|:..         :|:|...|  ||.|....  ||..:.|  ....|..||  
plant   185 T--NLSAPALPILATAQIPFPTNGILGNFNENF--NGNFNGNF--NGNFRGR--GRGGFMGRPRG 241

  Fly   206 --FKKHNFK 212
              |...||:
plant   242 GGFGGGNFR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 65/248 (26%)
RRM_SF 75..149 CDD:302621 30/73 (41%)
AT5G02530NP_195873.2 RRM_THOC4 108..182 CDD:410081 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - O PTHR19965
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.