DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and AT5G06210

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_196239.1 Gene:AT5G06210 / 830508 AraportID:AT5G06210 Length:146 Species:Arabidopsis thaliana


Alignment Length:70 Identity:17/70 - (24%)
Similarity:36/70 - (51%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDR-DGNSLGTAHLSFKYREEAFQIIEQFHGVRL 140
            :.:..|.:...:..:.|.|::.|.|.:..:..|| ...|.|...::|...:||.:.:.:|:|.:|
plant    36 LFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQL 100

  Fly   141 DGRRL 145
            :||.:
plant   101 NGRTI 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 17/70 (24%)
AT5G06210NP_196239.1 RRM_SF 34..113 CDD:473069 17/70 (24%)

Return to query results.
Submit another query.