DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and AT4G10110

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_192749.2 Gene:AT4G10110 / 826602 AraportID:AT4G10110 Length:173 Species:Arabidopsis thaliana


Alignment Length:90 Identity:25/90 - (27%)
Similarity:39/90 - (43%) Gaps:14/90 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VMVCNLDYGVDDDDIMELFNQDG-VVEKGFVHYDRDGNS---LGTAHLSFKYREEAFQIIEQFHG 137
            |.:.|:|..|.|..:.::..|.| |::   :|..||..:   .|.|...::..|.|...::.|.|
plant     9 VYIGNVDERVSDRVLYDIMIQAGRVID---LHIPRDKETDKPKGFAFAEYETEEIADYAVKLFSG 70

  Fly   138 -VRLDGRRLKL------HLVQNTRN 155
             |.|..|.||.      .|..|:.|
plant    71 LVSLYNRTLKFAISGQDKLQSNSAN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 22/82 (27%)
AT4G10110NP_192749.2 RRM1_SF3B4 9..83 CDD:409771 22/76 (29%)

Return to query results.
Submit another query.