DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and CP33

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_190806.1 Gene:CP33 / 824403 AraportID:AT3G52380 Length:329 Species:Arabidopsis thaliana


Alignment Length:102 Identity:25/102 - (24%)
Similarity:47/102 - (46%) Gaps:6/102 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RNGTGFIRKSKFK--QETLLKPPKKPTLVMVCNLDYGVDDDDIMELF-NQDGVVEKGFVHYDRDG 112
            |.|...:.::|.:  ..:.:..|.|   |...||.:.:....:.:.| :|.||:....::....|
plant   196 RGGENEVMRTKIRDNNRSYVDSPHK---VYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTG 257

  Fly   113 NSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHL 149
            .|.|...:||:..|.....:...:||.::||.|:|:|
plant   258 RSRGFGFISFESAENVQSALATMNGVEVEGRALRLNL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 19/74 (26%)
CP33NP_190806.1 RRM_SF 117..196 CDD:473069 25/102 (25%)
RRM2_NsCP33_like 220..295 CDD:410187 21/78 (27%)

Return to query results.
Submit another query.