DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and U11/U12-31K

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_187651.1 Gene:U11/U12-31K / 820203 AraportID:AT3G10400 Length:261 Species:Arabidopsis thaliana


Alignment Length:178 Identity:42/178 - (23%)
Similarity:68/178 - (38%) Gaps:41/178 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DDIIKMKFNKNKFVNAKNERVQGGSIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQETLLKPPKKP 74
            ||....:::........|.:.|..|..|.::.||         |:|.:            .|.|.
plant    14 DDTFYYRYSSVAAPPPSNPKHQPSSSAKSSAPGG---------GSGGL------------APSKS 57

  Fly    75 TLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDR-DGNSLGTAHLSFKYREEAFQIIEQFHGV 138
            || .|.|||:.:.:.||..||:..|.|.:..|..|| ...|.|.|.:.:..||:|.:........
plant    58 TL-YVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAK 121

  Fly   139 RLDGRRLKLHL-VQNTRNFKRTDVDDLSLRMGSFKTRFLQNGTFKTRS 185
            .|:||:|.:.: ..|.|                 .:.|::...:|.:|
plant   122 ILNGRKLTVSIAADNGR-----------------ASEFIKKRVYKDKS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 25/74 (34%)
U11/U12-31KNP_187651.1 RRM_ZCRB1 56..131 CDD:409827 26/75 (35%)
PTZ00368 154..>173 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.