DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and Alyref

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001381323.1 Gene:Alyref / 690585 RGDID:1594679 Length:256 Species:Rattus norvegicus


Alignment Length:232 Identity:74/232 - (31%)
Similarity:115/232 - (49%) Gaps:45/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNK---------FVNAKNERVQGGSIR--KRNSEGGLRGIQRSR--- 51
            |:|||.||||||||:  |:::         ...|.::..:||:::  .|.:.||  |..|:|   
  Rat     1 MADKMDMSLDDIIKL--NRSQRGGRGGGRGRGRAGSQGGRGGAVQAAARVNRGG--GPMRNRPAI 61

  Fly    52 -----NGTGFIRKSKFKQETLLKPPKKPTL----------------VMVCNLDYGVDDDDIMELF 95
                 .|.|..|.:.:.:...|....:..|                ::|.|||:||.|.||.|||
  Rat    62 ARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELF 126

  Fly    96 NQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNTRNFKRTD 160
            .:.|.::|..|||||.|.|||||.:.|:.:.:|.:.::|::||.||||.:.:.||.:..:.:|..
  Rat   127 AEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDTQRRP 191

  Fly   161 VDDLSLRMGSFKTRFLQNGTF---KTRSLQNGFQKSR 194
            ..  |:..|.. ||...:|:|   .||....|..:.|
  Rat   192 AQ--SINRGGM-TRNRGSGSFGGGGTRRGTRGGSRGR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 73/231 (32%)
RRM_SF 75..149 CDD:302621 35/89 (39%)
AlyrefNP_001381323.1 RRM_THOC4 107..180 CDD:410081 34/72 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.