DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and myef2

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001032500.1 Gene:myef2 / 641483 ZFINID:ZDB-GENE-051120-114 Length:557 Species:Danio rerio


Alignment Length:96 Identity:29/96 - (30%)
Similarity:44/96 - (45%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLD 141
            :.|.|||:.|....:.|:|...|.|.:..|..|:||.|.|...::|:...||.|.|..|:|..|.
Zfish   214 IFVANLDFKVGWKKLKEVFGMAGTVRRADVKEDKDGKSRGMGTVTFEQPLEAVQAISMFNGQMLF 278

  Fly   142 GRRLKLHLVQNTRNFKRTDVDDLSLRMGSFK 172
            .|::.:.:            ||.||....|:
Zfish   279 DRQMHVKM------------DDKSLPPDDFR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 29/96 (30%)
RRM_SF 75..149 CDD:302621 24/71 (34%)
myef2NP_001032500.1 RRM1_MYEF2 82..157 CDD:241102
RRM2_hnRNPM_like 214..287 CDD:240832 24/84 (29%)
RRM <436..>557 CDD:223796
RRM3_MYEF2 481..557 CDD:241106
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.