DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and alyref

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001098578.1 Gene:alyref / 560127 ZFINID:ZDB-GENE-070928-29 Length:280 Species:Danio rerio


Alignment Length:264 Identity:72/264 - (27%)
Similarity:106/264 - (40%) Gaps:88/264 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSIRKRNSEGGLRGI--------------QRSR 51
            |:|||.||||||||.          ..:|..||....|...|| ||.              :...
Zfish     1 MADKMDMSLDDIIKQ----------NRQRGGGGGRGGRGGRGG-RGATTGGGRGGGGGASGRLGN 54

  Fly    52 NGTGF---------------IRKSKFKQETLLKPPKKPT-------------------------- 75
            .|.||               :.:.:.:.....:|.:.|.                          
Zfish    55 TGGGFGGRGGGSGPMRNRQNLSRGRSRPAPYSRPKQLPDKWQHDLFDNGYSSNAGGGGGGGGGGA 119

  Fly    76 ------LVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQ 134
                  .::|.|||:||.|.||.|||.:.|.::|..|||||.|.|||||.:.|:.:.:|.:.::|
Zfish   120 GVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQ 184

  Fly   135 FHGVRLDGRRLKLHLVQNTRNF-KRTDVDDLSL--------RMGSFKTRFLQNGTFKTRSLQNGF 190
            ::||.||||.:.:.||.:..:. :||.:..|:.        |:|.|       |..|.|..:.|.
Zfish   185 YNGVPLDGRPMNIQLVTSQIDAQRRTPMQGLNRGGGGMNRNRVGGF-------GMQKGRGGRGGG 242

  Fly   191 QKSR 194
            .:.|
Zfish   243 SRGR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 71/263 (27%)
RRM_SF 75..149 CDD:302621 34/105 (32%)
alyrefNP_001098578.1 RRM <126..>226 CDD:223796 39/99 (39%)
RRM_THOC4 126..199 CDD:241124 34/72 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.