DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and Alyref2

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_062357.3 Gene:Alyref2 / 56009 MGIID:1913144 Length:218 Species:Mus musculus


Alignment Length:208 Identity:69/208 - (33%)
Similarity:96/208 - (46%) Gaps:45/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQE 65
            |:|||.||||||||:  |:|:              |:.|..||.|     ||.....|..:.:..
Mouse     1 MADKMDMSLDDIIKL--NRNQ--------------RRVNRGGGPR-----RNRPAIARGGRNRPA 44

  Fly    66 TLLKPPKKP---------------------TLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYD 109
            ...:|...|                     ..::|.|||:||.|.||.|||.:.|.::|..|.||
Mouse    45 PYSRPKPLPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYD 109

  Fly   110 RDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNTRNFKRTDVDDLSLRMGSFKTR 174
            |.|.|||||.:.|:.|.:|.:.::|:.||.||||.:.:.||.:..:.:|....  |...|.. ||
Mouse   110 RSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVTSQIDPQRRPAQ--SGNRGGM-TR 171

  Fly   175 FLQNGTFKTRSLQ 187
            ...:|.|..|..|
Mouse   172 SRGSGGFGGRGSQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 68/207 (33%)
RRM_SF 75..149 CDD:302621 34/73 (47%)
Alyref2NP_062357.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 24/74 (32%)
FYTT 3..>32 CDD:284488 19/49 (39%)
Sufficient for RNA-binding, interaction with NXF1-NXT1 16..37 9/39 (23%)
Interaction with HHV-8 ORF57 protein and with ICP27 from HHV-1 54..155 36/100 (36%)
RRM <75..>157 CDD:223796 36/81 (44%)
RRM_THOC4 75..149 CDD:241124 34/73 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..218 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.