DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and RBM11

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001307531.1 Gene:RBM11 / 54033 HGNCID:9897 Length:288 Species:Homo sapiens


Alignment Length:141 Identity:37/141 - (26%)
Similarity:59/141 - (41%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLD 141
            |.|.||:..|.::.:.|||.|.|.:.|..:..||:|.......:.||:.|.....|...:|:||.
Human    12 VFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLY 76

  Fly   142 GRRLKLHLVQNTRNFKRTDVDDLSLRMGSFKTRFLQNGTFKTRSLQNGFQKSRLFRN-------S 199
            ||.:                 ::..|.||.::....|.:|::....|    |..:||       |
Human    77 GRPI-----------------NVQYRFGSSRSSEPANQSFESCVKIN----SHNYRNEEMLVGRS 120

  Fly   200 SFKPRPFKKHN 210
            ||..:.|..:|
Human   121 SFPMQYFPINN 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 23/71 (32%)
RBM11NP_001307531.1 RRM_RBM11 9..83 CDD:410006 23/87 (26%)
PABP-1234 <12..223 CDD:130689 37/141 (26%)

Return to query results.
Submit another query.