DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and poldip3

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_012816254.2 Gene:poldip3 / 448024 XenbaseID:XB-GENE-952215 Length:433 Species:Xenopus tropicalis


Alignment Length:81 Identity:24/81 - (29%)
Similarity:43/81 - (53%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PKKPTLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQF 135
            |.:.|.:.|.||...|.::||:|||...|.:::..:      .|.|.|.:.|..:::|....:::
 Frog   285 PLEGTKMTVNNLHPRVTEEDIVELFCVCGALKRARL------LSPGAAEVVFVRKDDAVGAYKKY 343

  Fly   136 HGVRLDGRRLK--LHL 149
            :...|||:.:|  |||
 Frog   344 NNRYLDGQPMKCNLHL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 21/75 (28%)
poldip3XP_012816254.2 RRM_SKAR 289..357 CDD:410082 20/73 (27%)

Return to query results.
Submit another query.