DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and eif3g

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_957293.1 Gene:eif3g / 393974 ZFINID:ZDB-GENE-040426-1076 Length:293 Species:Danio rerio


Alignment Length:114 Identity:30/114 - (26%)
Similarity:51/114 - (44%) Gaps:15/114 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QRSRNGTG-----FIRKSKFKQETLLKPPKKP---TLVMVCNLDYGVDDDDIMELFNQDGVVEKG 104
            |..:|.||     .:|....::...::|.::.   ..:.|.||.....:.|:.|||...|.:.:.
Zfish   177 QPVQNKTGKYVPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI 241

  Fly   105 FVHYDRD-GNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQN 152
            ::..|:: |.|.|.|.:||..||:|.:.|....|...|      ||:.|
Zfish   242 YLAKDKNTGQSKGFALISFHRREDAARAIAGVSGFGYD------HLILN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 21/74 (28%)
eif3gNP_957293.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
eIF3g 29..149 CDD:463545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..206 6/28 (21%)
RRM_eIF3G_like 213..288 CDD:409842 24/78 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.