DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and srsf5a

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_957161.1 Gene:srsf5a / 335396 ZFINID:ZDB-GENE-030131-7336 Length:259 Species:Danio rerio


Alignment Length:201 Identity:52/201 - (25%)
Similarity:87/201 - (43%) Gaps:13/201 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VNAK---NERVQGGSIRKRNSEGGLRGI-QRSRNGTGFIRKSKFKQETLLKPPKKPTLVMVCNLD 83
            :|.|   :|||.....|.|...||..|: .|.....|..|:|:........|.:....::|.||.
Zfish    57 LNGKELCSERVTIEHARSRRGRGGGPGMGGRFSPRFGGYRQSRSGGSRYGPPVRTEHRIIVENLS 121

  Fly    84 YGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLH 148
            ..:...|:.:|..:.|  |..||...|...:.|.  :.|....:....||:..|..|:||:|||:
Zfish   122 SRISWQDLKDLMRKVG--EVTFVDAHRTKKNEGV--VEFASHSDMKNAIEKLDGTDLNGRKLKLY 182

  Fly   149 L-VQNTRNFKRTDVDDLSLRMGSFKTRFLQNGTFKTRS---LQNGFQKSRLFRNSSFKPRPFKKH 209
            . .:..|:..|:.....|......::|..:.|:.::||   .:...:||...|:.|..|.|.:|.
Zfish   183 EDRKRNRSRSRSRSRSSSRSRSPSRSRSPERGSKRSRSRSLSRTPEKKSTSNRSPSRSPTPQRKQ 247

  Fly   210 NFKSRA 215
            : :||:
Zfish   248 S-RSRS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 45/182 (25%)
RRM_SF 75..149 CDD:302621 21/73 (29%)
srsf5aNP_957161.1 RRM1_SRSF4_like 5..72 CDD:240783 5/14 (36%)
RRM2_SRSF4_like 113..184 CDD:241044 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.