Sequence 1: | NP_001246007.1 | Gene: | Ref2 / 34667 | FlyBaseID: | FBgn0032439 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957161.1 | Gene: | srsf5a / 335396 | ZFINID: | ZDB-GENE-030131-7336 | Length: | 259 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 52/201 - (25%) |
---|---|---|---|
Similarity: | 87/201 - (43%) | Gaps: | 13/201 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 VNAK---NERVQGGSIRKRNSEGGLRGI-QRSRNGTGFIRKSKFKQETLLKPPKKPTLVMVCNLD 83
Fly 84 YGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLH 148
Fly 149 L-VQNTRNFKRTDVDDLSLRMGSFKTRFLQNGTFKTRS---LQNGFQKSRLFRNSSFKPRPFKKH 209
Fly 210 NFKSRA 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ref2 | NP_001246007.1 | RRM | 2..>198 | CDD:223796 | 45/182 (25%) |
RRM_SF | 75..149 | CDD:302621 | 21/73 (29%) | ||
srsf5a | NP_957161.1 | RRM1_SRSF4_like | 5..72 | CDD:240783 | 5/14 (36%) |
RRM2_SRSF4_like | 113..184 | CDD:241044 | 21/74 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |