DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and rbm7

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_956219.1 Gene:rbm7 / 334784 ZFINID:ZDB-GENE-030131-6724 Length:252 Species:Danio rerio


Alignment Length:92 Identity:27/92 - (29%)
Similarity:45/92 - (48%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLD 141
            :.|.|||..|.::.|.|||.|.|.:.|..:..:.:|.|...|.::||:.......:...:|:||.
Zfish    11 LFVGNLDPQVTEEVIFELFLQAGPLIKVKIPKNNEGKSKLFAFVNFKHEVSVPYALNLLNGIRLH 75

  Fly   142 GRRLKL-------HLVQ------NTRN 155
            ||:|.:       |:.|      |::|
Zfish    76 GRQLNIKFKTGSSHINQEGKSPANSQN 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 23/78 (29%)
rbm7NP_956219.1 RRM_RBM7 8..82 CDD:410005 23/70 (33%)
PABP-1234 <11..195 CDD:130689 27/92 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..137 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..252
PRK12678 <171..>248 CDD:237171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.