DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and CG18259

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster


Alignment Length:181 Identity:42/181 - (23%)
Similarity:70/181 - (38%) Gaps:35/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FVNAKNERVQGG---SIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQETLLKPPKKPTL------- 76
            ||..::..:..|   :..:|.:.|| .|.:.|.:||.....:....:...:.|...:|       
  Fly   301 FVGKRDPHISHGIYANENRRKAVGG-GGARDSDSGTDSDGDAAAPSKNKRRSPSPLSLRTSNTKD 364

  Fly    77 ---VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGV 138
               ::|.||...|...||.|||:..|.|      ||......|||.:.:|..|.|.:.::.:|..
  Fly   365 GYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHR 423

  Fly   139 RLDGR------------RLKLHLVQN---TRNFKRTDVDDLSLRMGSFKTR 174
            :.|.:            |..:|...:   |.|....:||..:|....|:.|
  Fly   424 QFDDQPMHCVLVNPHSSRRSVHKASSRTVTTNSSGVEVDIDALHSVLFRVR 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 42/181 (23%)
RRM_SF 75..149 CDD:302621 23/95 (24%)
CG18259NP_573324.1 RRM <345..>443 CDD:223796 24/103 (23%)
RRM_SKAR 366..434 CDD:241125 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.