DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and Poldip3

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001123978.1 Gene:Poldip3 / 315170 RGDID:1311073 Length:420 Species:Rattus norvegicus


Alignment Length:156 Identity:38/156 - (24%)
Similarity:70/156 - (44%) Gaps:31/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMSLDDIIKM-KFNKNKFVNAKNERVQGGSIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQETLLK 69
            |:|:...:.: |..:|   :|....|...|:|.:    .|..:.|:     .:.|.:..:|.   
  Rat   218 KLSMSKTLPLTKVVQN---DAYTAPVLPSSVRTK----ALTNMSRT-----LVNKEELPKEL--- 267

  Fly    70 PPKKPTL-------VMVCNLDYGVDDDDIMELFNQDGVVEKG-FVHYDRDGNSLGTAHLSFKYRE 126
            ||.:|.|       :.|.||...|.::||:|||...|.:::. .||       .|.|.:.|..::
  Rat   268 PPAEPVLSPLEGTKMTVNNLHPRVTEEDIVELFCVCGALKRARLVH-------PGVAEVVFVKKD 325

  Fly   127 EAFQIIEQFHGVRLDGRRLKLHLVQN 152
            :|....::::...|||:.:|.:|..|
  Rat   326 DAITAYKKYNNRCLDGQPMKCNLHMN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 38/156 (24%)
RRM_SF 75..149 CDD:302621 21/81 (26%)
Poldip3NP_001123978.1 RRM 216..406 CDD:223796 38/156 (24%)
RRM_SKAR 280..348 CDD:241125 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.