DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and rbm8

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_594439.1 Gene:rbm8 / 2541998 PomBaseID:SPAC23A1.09 Length:121 Species:Schizosaccharomyces pombe


Alignment Length:70 Identity:14/70 - (20%)
Similarity:35/70 - (50%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LKPPK--KPTLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYD-RDGNSLGTAHLSFKYREEAF 129
            ::|.|  :..:::|..:.....::.:.:||...|.|:...::.| |.|...|.|.:.:...|:|.
pombe     1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRTGYVKGYALIEYATLEQAQ 65

  Fly   130 QIIEQ 134
            :.:::
pombe    66 KAVDE 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 12/61 (20%)
rbm8NP_594439.1 RRM_RBM8 4..90 CDD:409762 13/67 (19%)

Return to query results.
Submit another query.