DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and SPBC106.12c

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_595161.1 Gene:SPBC106.12c / 2540184 PomBaseID:SPBC106.12c Length:274 Species:Schizosaccharomyces pombe


Alignment Length:232 Identity:56/232 - (24%)
Similarity:86/232 - (37%) Gaps:63/232 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MKMSLDDIIKMKFNKNKFVNAKNERVQG---GSIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQET 66
            ::.|||:||             |||..|   ...|:|.|:.  |..::||....|.|.||....:
pombe     3 LEKSLDEII-------------NERTNGFDHKHSRRRGSQN--RISKKSRLTYKFKRASKEHNSS 52

  Fly    67 LLKPPKKPTL------------------------VMVCNLDYGVDDDDIMELFNQDGVVEKGFVH 107
            ....|.:..|                        |.|.||.|.|.:.|::.||.....: :..::
pombe    53 PDDGPWQHDLDQEQDAHPRTTHLQKRQHSENRFGVRVENLHYQVLEKDVLSLFENFHPI-RVIMN 116

  Fly   108 YDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNTRNFKRTDVDDL--SLRMGS 170
            |||.|.|.|:..:.|:..::|....:......|.|..:::........|.|  :.|:  |.|..|
pombe   117 YDRAGRSEGSCDVYFETSQDAEDAQKTLQSTNLKGSEIQISKKSPPSLFDR--ISDMPHSARKPS 179

  Fly   171 FKTRFLQNGTFKTRSLQNGFQKS-----RLFRNSSFK 202
            ..:|           ...||.:|     |.||:||.|
pombe   180 RSSR-----------SNRGFNRSSKKDDRSFRSSSKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 52/226 (23%)
RRM_SF 75..149 CDD:302621 20/97 (21%)
SPBC106.12cNP_595161.1 RRM 1..229 CDD:223796 56/232 (24%)
RRM_Aly_REF_like 87..158 CDD:240864 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.