DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and Rbmx2

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_775552.1 Gene:Rbmx2 / 209003 MGIID:1919414 Length:326 Species:Mus musculus


Alignment Length:162 Identity:41/162 - (25%)
Similarity:66/162 - (40%) Gaps:38/162 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KNKFVNAKNER-VQGGSIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQETLLKPPKKPTLVMVCNL 82
            |.|.:|..||| ||                      .|...|..:..|.     |....:.|..|
Mouse     6 KVKLINELNEREVQ----------------------LGVAEKVSWHSEY-----KHSAWIFVGGL 43

  Fly    83 DYGVDDDDIMELFNQDG-VVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLK 146
            .|.:.:.||:.:|:|.| :|....|...:.|.|.|...|.::.:......::.|:|:::.||.::
Mouse    44 PYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTVLAVDNFNGIKIKGRTIR 108

  Fly   147 LHLVQNTRNFKRT-DVDDLSLRMGSFKTRFLQ 177
            :..|.|.|..:.: ||||:        ||.||
Mouse   109 VDHVSNYRAPQESEDVDDV--------TRELQ 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 18/74 (24%)
Rbmx2NP_775552.1 RRM_ist3_like 27..115 CDD:409845 21/92 (23%)
PHA03307 113..>284 CDD:223039 10/28 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..326 8/24 (33%)
U2AF_lg 259..>324 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.