DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and Rbmxl1

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_033059.2 Gene:Rbmxl1 / 19656 MGIID:1343045 Length:388 Species:Mus musculus


Alignment Length:155 Identity:35/155 - (22%)
Similarity:65/155 - (41%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KPTLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGN-SLGTAHLSFKYREEAFQIIEQFH 136
            :|..:.:..|:...::..:..:|.:.|.:.:..:..||:.| |.|.|.::|:...:|.......:
Mouse     6 RPGKLFIGGLNTETNEKALEAVFGKYGRIVEILLMKDRETNKSRGFAFVTFESPADAKDAARDMN 70

  Fly   137 GVRLDGRRLKLHLVQNTR-NFK----------RTDVDDLSLRMGSFKTR-------FLQNGTFKT 183
            |..|||:.:|:.  |.|: :|:          |:......||.||..||       ::.:|.:..
Mouse    71 GKSLDGKAIKVE--QATKPSFESGRRGPPPPPRSRGPPRGLRGGSGGTRGPPSRGGYMDDGGYSM 133

  Fly   184 RSLQNGFQKSRLFRNSSFKPRPFKK 208
                 .|..|     ||..|.|.|:
Mouse   134 -----NFNMS-----SSRGPLPVKR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 16/74 (22%)
Rbmxl1NP_033059.2 RRM_RBMX_like 7..86 CDD:409816 18/80 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..388 24/102 (24%)
RBM1CTR 170..214 CDD:400429
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.