DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and aly-1

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_501588.1 Gene:aly-1 / 177735 WormBaseID:WBGene00000120 Length:223 Species:Caenorhabditis elegans


Alignment Length:147 Identity:34/147 - (23%)
Similarity:65/147 - (44%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERVQGGSIRKRNSEG----GLRGIQRSRNGTGFIRKSKFKQETLLKPPKKPTLVMVCNLDYGVDD 88
            :|...|.::||.|.|    ..|...:.|..:|.||.   ...::.....:...:.:.||.:.|..
 Worm    24 KRASVGGVKKRFSTGTAGPSRRPTAQPRRQSGGIRT---VDRSIPANENREVRINLSNLAHTVHS 85

  Fly    89 DDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNT 153
            .|:.:|| .:..:....|:::..|..:||..::...| .|.::|::|.||.|||:.:|..::.:.
 Worm    86 GDLRQLF-AEFKIRNVSVNFNEHGKPVGTGDVTLPKR-HADRLIQKFAGVSLDGKEIKFAIIDSA 148

  Fly   154 RNFKRTDVDDLSLRMGS 170
            ....|....:...|..|
 Worm   149 NIANRVKFPEAPRRAPS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 34/147 (23%)
RRM_SF 75..149 CDD:302621 20/73 (27%)
aly-1NP_501588.1 RRM_SF 73..144 CDD:388407 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.