DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and rnp-7

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_498565.2 Gene:rnp-7 / 176002 WormBaseID:WBGene00004390 Length:332 Species:Caenorhabditis elegans


Alignment Length:147 Identity:31/147 - (21%)
Similarity:63/147 - (42%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLD 141
            :.|..::|...:..:...|...|.::|..:.:|..|...|.|.:.:..:.|.....::..|:::|
 Worm   106 LFVGRINYETSESKLRREFEAYGKIKKLTMVHDEAGKPRGYAFIEYSDKAEMHTAYKKADGIKVD 170

  Fly   142 GRRLKLHLVQNTRNFKRTDVDDLSLRMG-----SFKTRFLQNGTFKTRSLQNGFQKSRLFRNSSF 201
            |:||   :|...|.  ||....|..|:|     :.|||..:: ..:.|.:.:||       ...:
 Worm   171 GKRL---VVDYERG--RTQKTWLPRRLGGGKGDTRKTREAKS-VIEEREIASGF-------GGGY 222

  Fly   202 KPRPFKKHNFKSRAFDT 218
            :.|..::...:.|..|:
 Worm   223 EDRDRERSGSRDRRQDS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 15/71 (21%)
rnp-7NP_498565.2 U1snRNP70_N 4..95 CDD:432406
RRM_snRNP70 103..192 CDD:409682 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.