DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and tiar-1

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_495121.1 Gene:tiar-1 / 173967 WormBaseID:WBGene00015943 Length:408 Species:Caenorhabditis elegans


Alignment Length:139 Identity:38/139 - (27%)
Similarity:59/139 - (42%) Gaps:23/139 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KPTLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHG 137
            :|..:.|.|||..|.:|.|..||||.|.|.|..|.:  ||::...|.:.|....:|.|.::..:.
 Worm    44 EPRTLYVGNLDSTVTEDFIATLFNQIGSVTKTKVIF--DGSNDPYAFVEFSDHGQASQALQTMNK 106

  Fly   138 VRLDGRRLKLH----------LVQNTRNFK------RTDVDDLSLR-----MGSFKTRFLQNGTF 181
            ..|..|.:|::          .:..||:|.      .::||:..||     .|......:...|.
 Worm   107 RLLLDREMKVNWAVEPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTN 171

  Fly   182 KTRSLQNGF 190
            .|:|...||
 Worm   172 TTKSKGYGF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 24/83 (29%)
tiar-1NP_495121.1 PABP-1234 47..>302 CDD:130689 37/136 (27%)
RRM2_TIA1_like 136..210 CDD:409789 10/45 (22%)

Return to query results.
Submit another query.