DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and Hnrnpm

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001103381.1 Gene:Hnrnpm / 116655 RGDID:620369 Length:729 Species:Rattus norvegicus


Alignment Length:128 Identity:36/128 - (28%)
Similarity:54/128 - (42%) Gaps:19/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GIQRSRNGTGFIRKSKFKQETLLKPPKKP-------------TLVMVCNLDYGVDDDDIMELFNQ 97
            |:.....|.|.|.    ...::|..|..|             :.|.|.||||.|....:.|:|:.
  Rat   165 GMGMGPGGPGMIN----IPPSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFSM 225

  Fly    98 DGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNTRNFKRTD 160
            .|||.:..:..|:||.|.|...::|:...||.|.|..|:|..|..|  .:|:..:.|...:.|
  Rat   226 AGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDR--PMHVKMDERALPKGD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 26/73 (36%)
HnrnpmNP_001103381.1 HnRNP_M_NLS 40..69 CDD:463289
RRM1_hnRNPM 71..146 CDD:410058
RRM2_hnRNPM 203..278 CDD:410060 27/76 (36%)
RRM3_hnRNPM 653..729 CDD:410062
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.