DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and CIRBP

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens


Alignment Length:115 Identity:25/115 - (21%)
Similarity:53/115 - (46%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRD-GNSLGTAHLSFKYREEAFQIIEQFHGVRL 140
            :.|..|.:..::..:.::|::.|.:.:..|..||: ..|.|...::|:..::|...:...:|..:
Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72

  Fly   141 DGRRLKLHLVQNTRNFKRTDVDDLSLRMGSFKTR-FLQNGTFKTRSLQNG 189
            |||::::     .:..|.:|......|.||...| |.:.|..:.|....|
Human    73 DGRQIRV-----DQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRG 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 15/72 (21%)
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 15/81 (19%)

Return to query results.
Submit another query.