DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and LOC11176155

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_003436593.1 Gene:LOC11176155 / 11176155 VectorBaseID:AGAMI1_003599 Length:420 Species:Anopheles gambiae


Alignment Length:82 Identity:21/82 - (25%)
Similarity:45/82 - (54%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YGVDDD----DIMELFNQDGVVEKGFVHYDRDGN-SLGTAHLSFKYREEAFQIIEQFHGVRLDGR 143
            :|::.|    .:|:||::.|.|:...:.||...| |.|.:.:.||:..:|.:...:.:|..|:||
Mosquito   296 FGMNPDTTEKTLMKLFSRYGHVKDIKLIYDGKTNVSRGYSFIYFKHASDARRAQRKLNGTMLEGR 360

  Fly   144 RLKLHLVQNTRNFKRTD 160
            ::::...::..:..|.|
Mosquito   361 KVRVDFSRSKPHEPRAD 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 19/69 (28%)
LOC11176155XP_003436593.1 PABP-1234 38..>381 CDD:130689 21/82 (26%)
RRM_SF 123..187 CDD:409669
RRM_SF 290..367 CDD:473069 19/70 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.