DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and ALYREF

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_005773.3 Gene:ALYREF / 10189 HGNCID:19071 Length:264 Species:Homo sapiens


Alignment Length:207 Identity:64/207 - (30%)
Similarity:100/207 - (48%) Gaps:36/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSIRKRNSEGGLRGIQRSRNGTGFIRK------ 59
            |:|||.||||||||:  |:::.......|.:|.:..:....||.:...|...|.|.||.      
Human     8 MADKMDMSLDDIIKL--NRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIAR 70

  Fly    60 ------SKFKQETLLKPPKKPT---------------------LVMVCNLDYGVDDDDIMELFNQ 97
                  .:.:.....:|.:.|.                     .::|.|||:||.|.||.|||.:
Human    71 GAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAE 135

  Fly    98 DGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNTRNFKRTDVD 162
            .|.::|..|||||.|.|||||.:.|:.:.:|.:.::|::||.||||.:.:.||.:..:.:|....
Human   136 FGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQ 200

  Fly   163 DLSLRMGSFKTR 174
            .:: |.|..:.|
Human   201 SVN-RGGMTRNR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 63/206 (31%)
RRM_SF 75..149 CDD:302621 34/94 (36%)
ALYREFNP_005773.3 FYTT 4..>23 CDD:284488 12/16 (75%)
RRM <114..>210 CDD:223796 39/96 (41%)
RRM_THOC4 114..187 CDD:241124 34/72 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.