Sequence 1: | NP_001246007.1 | Gene: | Ref2 / 34667 | FlyBaseID: | FBgn0032439 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005773.3 | Gene: | ALYREF / 10189 | HGNCID: | 19071 | Length: | 264 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 64/207 - (30%) |
---|---|---|---|
Similarity: | 100/207 - (48%) | Gaps: | 36/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSIRKRNSEGGLRGIQRSRNGTGFIRK------ 59
Fly 60 ------SKFKQETLLKPPKKPT---------------------LVMVCNLDYGVDDDDIMELFNQ 97
Fly 98 DGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNTRNFKRTDVD 162
Fly 163 DLSLRMGSFKTR 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ref2 | NP_001246007.1 | RRM | 2..>198 | CDD:223796 | 63/206 (31%) |
RRM_SF | 75..149 | CDD:302621 | 34/94 (36%) | ||
ALYREF | NP_005773.3 | FYTT | 4..>23 | CDD:284488 | 12/16 (75%) |
RRM | <114..>210 | CDD:223796 | 39/96 (41%) | ||
RRM_THOC4 | 114..187 | CDD:241124 | 34/72 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0533 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1369069at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001223 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_101458 | |
Panther | 1 | 1.100 | - | - | O | PTHR19965 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.780 |