DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and Gm21312

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001257571.1 Gene:Gm21312 / 100861901 MGIID:5434667 Length:264 Species:Mus musculus


Alignment Length:178 Identity:52/178 - (29%)
Similarity:79/178 - (44%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSIRKRNSE------------------------ 41
            |:|||.|||:||||:...:.:..:..:.||..|:..||...                        
Mouse     4 MADKMDMSLEDIIKLTKIQQRRHDRPDSRVNRGTGSKRYRPAFTHGGRNRLAPYCRPKQLPDKWQ 68

  Fly    42 -----GGLRGIQRSRNGTGFIRKSKFKQETLLKPPKKPTLVMVCNLDYGVDDDDIMELFNQDGVV 101
                 ||.||  ::...||                   ..:.:.||.:||.|.||..||.:.|.:
Mouse    69 HDLFIGGFRG--QNHVDTG-------------------GKLFLSNLHFGVSDADIQLLFAEFGTL 112

  Fly   102 EKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHL 149
            :|..|||||.|.|||||.:.|:.:.:|.:.:.:::|..||||.:.:.|
Mouse   113 KKSAVHYDRCGRSLGTAQVHFERKADALKAMREYNGAPLDGRPMNIQL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 51/177 (29%)
RRM_SF 75..149 CDD:302621 29/73 (40%)
Gm21312NP_001257571.1 FYTT 6..>59 CDD:284488 15/52 (29%)
RRM <79..>186 CDD:223796 32/101 (32%)
RRM_THOC4 86..160 CDD:241124 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.