DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and poldip3

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_009297280.4 Gene:poldip3 / 100536140 ZFINID:ZDB-GENE-120201-2 Length:502 Species:Danio rerio


Alignment Length:95 Identity:25/95 - (26%)
Similarity:47/95 - (49%) Gaps:9/95 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RKSKFKQETLLKP---PKKPTLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAH 119
            |.:..:..|..:|   |.:.|.:.|.||...|.::||:|||...|.:::..:      ..:|.|.
Zfish   325 RDTSAQTHTPTQPVFSPLEGTKITVTNLHPRVTEEDIVELFCVCGALKRARL------AKVGVAE 383

  Fly   120 LSFKYREEAFQIIEQFHGVRLDGRRLKLHL 149
            :.|..:|:|.....:::...|||:.:|.:|
Zfish   384 VVFVRKEDAVSAYRKYNNRCLDGQPMKCNL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 20/73 (27%)
poldip3XP_009297280.4 RRM_SKAR 345..413 CDD:410082 20/73 (27%)

Return to query results.
Submit another query.