DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and poldip3

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_009297280.3 Gene:poldip3 / 100536140 ZFINID:ZDB-GENE-120201-2 Length:520 Species:Danio rerio


Alignment Length:95 Identity:25/95 - (26%)
Similarity:47/95 - (49%) Gaps:9/95 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RKSKFKQETLLKP---PKKPTLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAH 119
            |.:..:..|..:|   |.:.|.:.|.||...|.::||:|||...|.:::..:      ..:|.|.
Zfish   343 RDTSAQTHTPTQPVFSPLEGTKITVTNLHPRVTEEDIVELFCVCGALKRARL------AKVGVAE 401

  Fly   120 LSFKYREEAFQIIEQFHGVRLDGRRLKLHL 149
            :.|..:|:|.....:::...|||:.:|.:|
Zfish   402 VVFVRKEDAVSAYRKYNNRCLDGQPMKCNL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 25/95 (26%)
RRM_SF 75..149 CDD:302621 20/73 (27%)
poldip3XP_009297280.3 RRM_SKAR 363..431 CDD:241125 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.