DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and Gm4312

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001160108.1 Gene:Gm4312 / 100043247 MGIID:3782493 Length:289 Species:Mus musculus


Alignment Length:178 Identity:53/178 - (29%)
Similarity:84/178 - (47%) Gaps:48/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSIRKRNSEGGLRGIQRSRNGTG-------FIR 58
            |:|||.|||:||:|:            .::|.|.:.:.:|        |.:.|||       |..
Mouse     4 MADKMDMSLEDILKL------------NKMQQGRLDRPDS--------RVKRGTGPKRYRPAFTH 48

  Fly    59 KSKFKQETLLKPPKKPT---------------------LVMVCNLDYGVDDDDIMELFNQDGVVE 102
            ..:.:.....:|.:.|.                     .:.:.||.:||.|.||..||.:.|.::
Mouse    49 DGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLK 113

  Fly   103 KGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLV 150
            |..|||||.|.||||||:.|:.:.:|.:.:.:::|..||||.:.:|||
Mouse   114 KSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 52/177 (29%)
RRM_SF 75..149 CDD:302621 30/94 (32%)
Gm4312NP_001160108.1 FYTT 6..>59 CDD:284488 17/72 (24%)
RRM <79..>195 CDD:223796 33/83 (40%)
RRM_THOC4 86..160 CDD:241124 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369069at2759
OrthoFinder 1 1.000 - - FOG0001223
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.