DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bun and Tsc22d4

DIOPT Version :9

Sequence 1:NP_001036357.2 Gene:bun / 34665 FlyBaseID:FBgn0259176 Length:1331 Species:Drosophila melanogaster
Sequence 2:NP_076399.4 Gene:Tsc22d4 / 78829 MGIID:1926079 Length:387 Species:Mus musculus


Alignment Length:379 Identity:117/379 - (30%)
Similarity:148/379 - (39%) Gaps:82/379 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   917 PNAESETESFITASNPGGNRKRAFSNPHIGGPNDPSFMHRLNPQL---YYYNKSQSGRSSFCVD- 977
            ||.:...:       |||.......:|..|.|.....:.:|...|   |     :.||.: ||| 
Mouse    44 PNGDPNPD-------PGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPY-----RRGRWT-CVDV 95

  Fly   978 --ESLWPTN------NPNGAVSDTNLYMGSSTDEDYEEAIDQFSPTI----YTTRSASRAIPIPN 1030
              ..|.|.:      ...||...|.   |.|.|...|.|....|..|    .:....|...|.|.
Mouse    96 YERDLEPPSFGRLLEGIRGASGGTG---GRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPT 157

  Fly  1031 SAGSSPQHQMHHSQPRIAIGINQMEGGGPTR-STGAFSASPSIYAYPHSPFYASSPETSFGSAAM 1094
            |.|  ||.:....      |:.|:.|.|..: .|...||||.....|       .|.|...:..:
Mouse   158 SPG--PQARSFTG------GLGQLAGPGKAKVETPPLSASPPQQRPP-------GPGTGDSAQTL 207

  Fly  1095 P---------GHPAASSRISFSYDPAFQ---RLQVPNASG-----DRRPRSPL---------ECA 1133
            |         |..||:..:|...|.|.:   .|..|..:|     |.||.||.         :..
Mouse   208 PSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSP 272

  Fly  1134 SVFAAVAA----AATCGDAAGGAADTVISSASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVL 1194
            ..|.|.||    .|....|..|..|:...|.|| |.|.|||||||||||||||||.|||||||||
Mouse   273 DPFGAAAAQSLSLARSMLAISGHLDSDDDSGSG-SLVGIDNKIEQAMDLVKSHLMFAVREEVEVL 336

  Fly  1195 KERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPAV 1248
            ||:|.:|.::...||.||.:|::....|.|.||.   ....|...|:....|::
Mouse   337 KEQIRDLAERNAALEQENGLLRALASPEQLAQLP---SSGLPRLGPSAPNGPSI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bunNP_001036357.2 TSC22 1176..1223 CDD:279505 27/46 (59%)
Tsc22d4NP_076399.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 10/47 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..232 26/111 (23%)
TSC22 318..372 CDD:279505 31/56 (55%)
Leucine-zipper 336..357 9/20 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..387 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844861
Domainoid 1 1.000 70 1.000 Domainoid score I9498
eggNOG 1 0.900 - - E1_KOG4797
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001302
OrthoInspector 1 1.000 - - otm44335
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.