DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bun and zgc:65895

DIOPT Version :9

Sequence 1:NP_001036357.2 Gene:bun / 34665 FlyBaseID:FBgn0259176 Length:1331 Species:Drosophila melanogaster
Sequence 2:NP_956868.1 Gene:zgc:65895 / 393546 ZFINID:ZDB-GENE-040426-1466 Length:135 Species:Danio rerio


Alignment Length:93 Identity:57/93 - (61%)
Similarity:71/93 - (76%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1158 SSASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKS-NIPQ 1221
            ||:||.|.|||||||||||||||||||.|||||||||||:|.|||::.::||.||::||: :.|:
Zfish    37 SSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELMERNSQLEQENALLKNLSSPE 101

  Fly  1222 ETLQ-QLQLQLQLAAPP--ATPAIQAAP 1246
            :.|| |.|.|.|..:|.  |.|.:..||
Zfish   102 QLLQFQTQTQTQSGSPTSGAPPTLPTAP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bunNP_001036357.2 TSC22 1176..1223 CDD:279505 31/47 (66%)
zgc:65895NP_956868.1 TSC22 55..101 CDD:279505 30/45 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589768
Domainoid 1 1.000 68 1.000 Domainoid score I9683
eggNOG 1 0.900 - - E1_KOG4797
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001302
OrthoInspector 1 1.000 - - otm25341
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.