DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bun and Tsc22d3

DIOPT Version :9

Sequence 1:NP_001036357.2 Gene:bun / 34665 FlyBaseID:FBgn0259176 Length:1331 Species:Drosophila melanogaster
Sequence 2:NP_001070832.1 Gene:Tsc22d3 / 14605 MGIID:1196284 Length:201 Species:Mus musculus


Alignment Length:97 Identity:54/97 - (55%)
Similarity:68/97 - (70%) Gaps:4/97 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1159 SASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKSNIPQET 1223
            ||||.|.||:||||||||||||:|||.|||||||||||:|.||::|.::||.||::||:....|.
Mouse   105 SASGASVVALDNKIEQAMDLVKNHLMYAVREEVEVLKEQIRELLEKNSQLERENTLLKTLASPEQ 169

  Fly  1224 LQQLQLQLQLAAP----PATPAIQAAPAVQSV 1251
            |::.|.:|....|    |.||....||...:|
Mouse   170 LEKFQSRLSPEEPAPEAPETPETPEAPGGSAV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bunNP_001036357.2 TSC22 1176..1223 CDD:279505 29/46 (63%)
Tsc22d3NP_001070832.1 TSC22 122..178 CDD:366499 32/55 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844863
Domainoid 1 1.000 70 1.000 Domainoid score I9498
eggNOG 1 0.900 - - E1_KOG4797
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001302
OrthoInspector 1 1.000 - - otm44335
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.