DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bun and tsc22d3

DIOPT Version :9

Sequence 1:NP_001036357.2 Gene:bun / 34665 FlyBaseID:FBgn0259176 Length:1331 Species:Drosophila melanogaster
Sequence 2:XP_012823446.1 Gene:tsc22d3 / 100145088 XenbaseID:XB-GENE-1004589 Length:202 Species:Xenopus tropicalis


Alignment Length:103 Identity:54/103 - (52%)
Similarity:67/103 - (65%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1159 SASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKSNIPQET 1223
            ||||.|.|||||||||||||||:|||.|||||||||||:|.||::|.::||.||.:||:....|.
 Frog   106 SASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEVLKEQIKELVEKNSQLEKENHLLKNLASPEQ 170

  Fly  1224 LQQLQLQLQLAAPPATPAIQAAPAVQSVVAPAAAGQAV 1261
            :::.|.:|.....|....:....|.|.      ||.||
 Frog   171 MKKFQSRLPQDETPIKTKLDFLRASQK------AGSAV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bunNP_001036357.2 TSC22 1176..1223 CDD:279505 29/46 (63%)
tsc22d3XP_012823446.1 TSC22 123..178 CDD:366499 31/54 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9356
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001302
OrthoInspector 1 1.000 - - otm49512
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.