DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp33Eb and slco2a1

DIOPT Version :9

Sequence 1:NP_609570.1 Gene:Oatp33Eb / 34662 FlyBaseID:FBgn0032435 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_001083051.1 Gene:slco2a1 / 100038802 ZFINID:ZDB-GENE-060606-3 Length:221 Species:Danio rerio


Alignment Length:162 Identity:33/162 - (20%)
Similarity:65/162 - (40%) Gaps:45/162 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PDDSVDCGIKGLGWCRGPGCQKYARLRTFILVLAISGTLQGACESYFRVSAKQASFQFGWNPLIV 85
            |..|:.|.||....|.|              :|.::..|.   .|||:.:......::|.:.|  
Zfish    11 PKPSLFCNIKIFVLCHG--------------LLQLTQLLY---SSYFKSTITTIERRYGLDSL-- 56

  Fly    86 DWLLVASGLFQAVFAL------AF-AYWADVYHPIKWL-VGTLMLQAVTCVVAVIPSIMNFADGN 142
                 :||...::..:      || :|.....|..::: :|.|::.    :.|:|.::.:|....
Zfish    57 -----SSGTISSLHEVGNTVLKAFVSYLGSRVHRPRFIGLGGLLMS----ISAMILALPHFLSQP 112

  Fly   143 QAKDALLDA---NMCATSLAQFQRLTLTEAQS 171
            ...|::|.|   :||      :.|..:|.|::
Zfish   113 YTYDSVLHASRQDMC------YLRANVTGAEA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oatp33EbNP_609570.1 oat 23..619 CDD:273279 32/160 (20%)
MFS 50..>267 CDD:119392 26/133 (20%)
KAZAL_SLC21 430..483 CDD:238650
slco2a1NP_001083051.1 OATP 21..>110 CDD:281175 20/116 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.