DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5421 and atp6ap1lb

DIOPT Version :9

Sequence 1:NP_001260418.1 Gene:CG5421 / 34661 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001188332.1 Gene:atp6ap1lb / 561786 ZFINID:ZDB-GENE-050208-117 Length:333 Species:Danio rerio


Alignment Length:291 Identity:52/291 - (17%)
Similarity:102/291 - (35%) Gaps:79/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 ALQRRKSQKTQHMSIKNKIDGQ----PSNSDTEVE-----------LQPH------------QIS 217
            |:..|.|:...:.:::.:.||:    ||.|..|..           |||:            ::.
Zfish    29 AILDRSSEVPPYQAVRIRTDGEHVESPSASHEESYSPAAENPLRRILQPYGWHLHAQPRTKRKLL 93

  Fly   218 QSQADN----MTVLRNEMIVLTFRSILLATKEQRSVLSPFNRTEVMLAQG-------------RE 265
            ||.:..    :||..|..|.:.|::..||.:.:.:..  .:.||.:....             :.
Zfish    94 QSTSSGPYSPLTVAYNGKICILFKAKRLAIRYRNNTF--LDLTERVFGSSAQVDTKGSVCTKEKA 156

  Fly   266 PLQVGLLNSHDIFGGIVMVLNTELGPLIVELIPSQGNWYLTRMIFM--NNTH---------YPRD 319
            .|.:.|.:..||.|   :|:..::.....|.:..  ||:....:.:  |.||         |...
Zfish   157 TLSLRLGDVEDIKG---LVIRLQMSNTFYESVGQ--NWFTLDSVHIHYNWTHEATFNATEVYAPA 216

  Fly   320 LYFYGFEF--------SLCCTDITVYSSEASRLSFFDFHLDILWQDKDNGLDLQ-YEVKPCWNCS 375
            .|.|..:.        :|........||....::|.||.:        ...::| .:.....:|:
Zfish   217 TYSYHCQHVSSLQKYDTLLVPSSYTDSSANWHITFTDFQI--------QAFNVQSNKFASASDCA 273

  Fly   376 ILMTPTMAQTIFVVLIIAAILWMGLAILLSI 406
            ...||.:...:...||:..:|...|.:::.:
Zfish   274 TFFTPAILMGLITSLILLLVLAYALHMVVHL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
atp6ap1lbNP_001188332.1 Lamp <151..296 CDD:279622 28/157 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002234
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12471
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.