DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5421 and Atp6ap1l

DIOPT Version :9

Sequence 1:NP_001260418.1 Gene:CG5421 / 34661 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001139351.1 Gene:Atp6ap1l / 435376 MGIID:3648665 Length:336 Species:Mus musculus


Alignment Length:99 Identity:22/99 - (22%)
Similarity:40/99 - (40%) Gaps:18/99 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SQKTQHMSIKNKIDGQPSNSDTEVELQPHQISQSQA----DNMTVLRNEMIVLTFRS---ILLAT 243
            |:::..:|:|...|..|.:.|....|..:....||:    ..:.::.|..:..||.:   ..|:|
Mouse   134 SEESATLSLKFGDDEDPKDIDIRFTLTNYNKLASQSWFSLHRVEIIFNNSVQATFNATGIYALST 198

  Fly   244 KEQR-SVLSPFNRTEVMLAQGREPLQVGLLNSHD 276
            ...| ..:|...|.:.:|          ||:|.|
Mouse   199 YSYRCQRVSSLRRNDALL----------LLSSSD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
Atp6ap1lNP_001139351.1 Lamp <123..277 CDD:279622 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002234
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12471
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.