DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5421 and VhaAC45

DIOPT Version :9

Sequence 1:NP_001260418.1 Gene:CG5421 / 34661 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_610470.1 Gene:VhaAC45 / 35944 FlyBaseID:FBgn0262515 Length:379 Species:Drosophila melanogaster


Alignment Length:439 Identity:98/439 - (22%)
Similarity:171/439 - (38%) Gaps:106/439 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIVPIAFGSAPVTSSPPVLVWGVDTPKATSIFQP----VTTAQFRKIIRNLQKNNMIVIYLASEL 69
            ||.....|:| |....||.:||     |.|:.:|    |:..:|.:.:..|.:::|:|.:..:.|
  Fly     6 LIALCVIGAA-VAEQTPVFLWG-----ANSVAKPSLKTVSQVEFAEQLAALLEDHMVVAFEENGL 64

  Fly    70 AAKDINC-----DLCFPYLTKIQPMNYYSQVEEPLNAVERVAEKTGDIIWHIPKISEMGSLEAEM 129
            ::||..|     ..|:..|..:.|..||:.||.|..|:..||.|           .|..|::|..
  Fly    65 SSKDFLCSNSQAQSCYAQLQGVSPKTYYTSVENPSEALRSVAAK-----------REHNSIDASG 118

  Fly   130 EL----PCQKGEIHAFSFND------RNLLAHDAAMAVATYQFSDCPVVHVYTAYTEEDKALQRR 184
            :|    .|..|.....:|.|      .:|.:||||:|..:.|| :|.|.::|.|.......:|||
  Fly   119 KLTTPAKCAVGTALFVTFEDAAESREASLESHDAAIAAISKQF-ECKVAYLYLAAPSTAPVVQRR 182

  Fly   185 KSQKTQHMSIKNKIDGQPSNSDTEVELQPHQISQSQADNMTVLRNEMIVLTFRSILLATKEQRSV 249
            ..:.|               :.|...:.....:|.|.....:|.|.                   
  Fly   183 TRRDT---------------AATTGGIMWKSTNQFQIFYTALLYNG------------------- 213

  Fly   250 LSPFNRTEVMLAQGREPLQVGLLNSHDIFGGIVMVLNTELGPLIVELIPSQGNWYLTRMIFMNN- 313
             :|...|::.|.           ||......:||..:....|:..:::.:.|.:.|:.:::.|| 
  Fly   214 -NPITVTDLKLT-----------NSSSTKLSVVMDTSVADKPITFDVVYNGGYFSLSNLVYDNNN 266

  Fly   314 -----THYPRDLYFYGFEFSLCCTDITVYSSEASR----LSFFDFHLDILWQDKDNGLDLQYEVK 369
                 .:.|.       .||..|.::|:.|:..:.    |||....|...:   |......:...
  Fly   267 FRSSGVNAPT-------TFSYSCGNLTLESAAVNNMYNTLSFKSLQLQAPF---DGTYKEDFPFG 321

  Fly   370 PCWNCSILMTPTMAQTIFVVLIIAAILWMGLAILLSIGQNQLMQNANDP 418
            ..|:|...:||.:...:|||.::..|:::|:..::.|   ..|...:||
  Fly   322 DSWDCVGFVTPGILMGLFVVALLLVIMFVGVCWMMDI---NTMDRFDDP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
VhaAC45NP_610470.1 ATP-synt_S1 244..376 CDD:368630 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3868
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002234
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12471
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.