DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5421 and vha-19

DIOPT Version :9

Sequence 1:NP_001260418.1 Gene:CG5421 / 34661 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_500332.1 Gene:vha-19 / 177103 WormBaseID:WBGene00021952 Length:451 Species:Caenorhabditis elegans


Alignment Length:291 Identity:54/291 - (18%)
Similarity:90/291 - (30%) Gaps:107/291 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LPCQKGEIHAFSFNDRNLLAHDAAMAVATYQFSDCPVVHVY-------------TAYTEEDKALQ 182
            :.||..:...|| |.|.:....||..|.:....: |||.:.             .|||.|..|..
 Worm    12 MACQAYDAVLFS-NSREIGGTPAAKLVESATAEE-PVVFIVNPDFTLGQFSVKANAYTSEPSADY 74

  Fly   183 RRKSQKTQHMSIKNKIDGQPSNSDTEVELQPHQISQSQADNMTVLRNEMIVLTFRSILLATKEQR 247
            ..||.|..:..              |.:...|||..:||.                 .|::.:|.
 Worm    75 LAKSVKNSNFH--------------ESQYFSHQIEATQAQ-----------------WLSSADQY 108

  Fly   248 SVLSP----FNRTEVMLAQGREPL------QVGLLNS-----HDIFGGIVMVLNTELG------- 290
            |..||    :......:.|..|.|      .||::.|     |:....:..|...|..       
 Worm   109 SAGSPIYIIYGEEWTSMEQLAEQLISKIDNSVGIITSTDAVAHEKSSRVKRVATDEFNSDSENSA 173

  Fly   291 ----------PLIV--------ELIPSQGN---WYL-----------TRMIFMNNTHYPRDLYFY 323
                      ||::        .:.|:.|:   :||           .::::..|.:.|...:.:
 Worm   174 AAEANGGFPFPLVIPPYNQTFYSVKPTNGHSCLFYLEGLTVVVEQKKEKVLYYANAYIPGSNFTW 238

  Fly   324 GF-EFSLCCTDITVYSSEASRLSFFDFHLDI 353
            .: |..:.|.:.|:..      ..|..||.:
 Worm   239 AYSETDVTCPNGTIGD------FIFKIHLTL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
vha-19NP_500332.1 ATP-synt_S1 16..430 CDD:283484 52/287 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002234
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12471
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.