DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5421 and atp6ap1la

DIOPT Version :9

Sequence 1:NP_001260418.1 Gene:CG5421 / 34661 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001373640.1 Gene:atp6ap1la / 100000415 ZFINID:ZDB-GENE-110318-1 Length:323 Species:Danio rerio


Alignment Length:316 Identity:57/316 - (18%)
Similarity:111/316 - (35%) Gaps:93/316 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 MAVATYQFSDCPVVHVY---TAYTE--EDKALQRRKSQKTQHMSIKNKIDGQPSN-SDTEV---- 209
            |::|.:.|....:...|   :|:.|  .|.|..|       .:||::...|..|: |..|.    
Zfish     8 MSLALFSFVFLQISSSYEQLSAFVEGSSDDAPSR-------DISIQDGGSGSSSSLSAAEAPLRR 65

  Fly   210 ELQPH----------QISQSQA----DNMTVLRNEMIVLTFRSILLA-----------TKEQRSV 249
            .|||:          ::.||..    ..::|..|....:.||:..||           |::..|.
Zfish    66 ALQPYGWQLDVPPRRKLLQSPGLLLYSPLSVTYNGKTCILFRARKLAIRYRNHSLVDLTEKTFSP 130

  Fly   250 LSPFNRTEVMLAQGREPLQVGLLNSHDIFGGIVMVLNTELGPLIVELIPSQG-NWYLTRMIFMNN 313
            .:|.:......::.:..|.:...:..|:.|   :.:..::.....|   |.| ||:.     ::|
Zfish   131 DAPLDTKGSFCSKDKAILNLRFGDVEDLRG---LSIRLQMSNTFYE---SAGQNWFT-----LDN 184

  Fly   314 THYPRDLYFYGFEFSLCCTDI------TVYSSEASRLSFFD--------------FHLDILWQDK 358
            .|..   |.:.:|.:...||:      :.:....|.|..:|              :|:..     
Zfish   185 VHIH---YNWTYEATFNATDVYAPSTNSYHCQHVSSLQKYDTLLVPSANTDHAANWHITF----- 241

  Fly   359 DNGLDLQYEV--------KPCWNCSILMTPTMAQTIFVVLIIAAILWMGLAILLSI 406
               .|.|.:.        .|..:|:...||.:...:...||:..:|...|.:::.:
Zfish   242 ---TDFQIQAFNVQSSKFAPASDCATFFTPAILMGLITSLILLLVLAYALHMVVHL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
atp6ap1laNP_001373640.1 ATP-synt_S1 161..310 CDD:399083 25/153 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002234
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12471
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.