DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MOGAT3 and Dgat2

DIOPT Version :9

Sequence 1:XP_005250366.1 Gene:MOGAT3 / 346606 HGNCID:23249 Length:344 Species:Homo sapiens
Sequence 2:NP_610318.1 Gene:Dgat2 / 35719 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster


Alignment Length:283 Identity:109/283 - (38%)
Similarity:152/283 - (53%) Gaps:28/283 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    39 FFSLLVFVLLFTS--------------LWPFSVFYLVWLYVDWDTPNQGGRRSEWI--RNRAIWR 87
            ||:.::.:||..|              :....|.||.:::|...........:.|:  |...:.|
  Fly    23 FFTSMLLILLSVSFLLVAGSLIYGGLLVRSLMVTYLAYVFVHHKKTQSVVDGNGWMITRTNLLHR 87

Human    88 QLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLF 152
            ..|||:||:||||||||..:||:|.:.||||:.||...|...|.:.:.:|||.:||.|..|...|
  Fly    88 HYRDYFPVELVKTAELPATKNYILASFPHGILGTGIGINMGLEISKWLELFPQVRPKLGTLDQHF 152

Human   153 YLPVYRDYIMSFGLCPVSRQSLDFILSQPQ-----------LGQAVVIMVGGAHEALYSVPGEHC 206
            ::|..|:.:..:||..||:::|..:||:..           ...||.|:||||.||:.|.||::.
  Fly   153 HVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTSNAVAILVGGAQEAMDSHPGQYI 217

Human   207 LTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRG 271
            |||:.||||||:|:|.|:|:||.:||||.|||...|....|.....|...|||.|.||.|..|||
  Fly   218 LTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLLRRFQDFVKKLTGVSPLIPVGRG 282

Human   272 LFSATSWGLLPFAVPITTVGECP 294
            .|:.| :|.|||...|..|...|
  Fly   283 FFNYT-FGFLPFRRRIVQVVGAP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MOGAT3XP_005250366.1 LPLAT 45..290 CDD:327403 105/271 (39%)
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 100/232 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146791
Domainoid 1 1.000 214 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.