DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MOGAT3 and CG1941

DIOPT Version :9

Sequence 1:XP_005250366.1 Gene:MOGAT3 / 346606 HGNCID:23249 Length:344 Species:Homo sapiens
Sequence 2:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster


Alignment Length:290 Identity:111/290 - (38%)
Similarity:161/290 - (55%) Gaps:25/290 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    30 VLTFLFM--GPFFSLLVFVLLFTSLW-PFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIW--RQL 89
            :|:|:.:  |.:|.:...:...:.|| ...|.|||::|.:....:.....:.|..||..|  |..
  Fly    25 ILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRHY 89

Human    90 RDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYL 154
            |||:||:|||||||||::||:|.:.||||:.||...|...:.:.:.||||.:||.:|.|...|..
  Fly    90 RDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLT 154

Human   155 PVYRDYIMSFGLCPVSRQSLDFILSQPQ-----------LGQAVVIMVGGAHEALYSVPGEHCLT 208
            |:.|..:.|:||..||:::|.::|::..           ...||.|:||||.|||.|.||::.||
  Fly   155 PIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILT 219

Human   209 LQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLF 273
            |:.|||||::|:|.|:|:||.:||||.||....|....|.....|...|::.|.||.|..|||:|
  Fly   220 LKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIF 284

Human   274 SATSWGLLP--------FAVPITTVGECPP 295
            : .|:|.||        ...||..|....|
  Fly   285 N-YSFGFLPNRRRIVQVVGAPIDVVQSDQP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MOGAT3XP_005250366.1 LPLAT 45..290 CDD:327403 105/266 (39%)
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 106/265 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146792
Domainoid 1 1.000 214 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.