DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MOGAT3 and CG34348

DIOPT Version :9

Sequence 1:XP_005250366.1 Gene:MOGAT3 / 346606 HGNCID:23249 Length:344 Species:Homo sapiens
Sequence 2:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster


Alignment Length:231 Identity:60/231 - (25%)
Similarity:93/231 - (40%) Gaps:49/231 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    30 VLTFLFMGPFFSLLVFV-LLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNR----AIW-RQ 88
            ::|||..      |||| |::.|   |.|.::..|:.........|.|:.|...|    ||| ..
  Fly    35 IVTFLLP------LVFVALIYIS---FLVLFIYKLHRQVIMRAVQGDRNFWRVGRKIVAAIWDAH 90

Human    89 LRDYYPVKLVKTAELPPDRN----YVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLA 149
            .|.|:..:::....:|.:..    |..||.|        :..:...|....|     |..|....
  Fly    91 ARIYHGYEVIGLENVPQEGPALIVYYHGAIP--------IDMYYLNSRMLLQ-----RERLIYTI 142

Human   150 G---LFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTL-- 209
            |   ||.||.:.....:|.:.|.:.||...||..   |..:.|..||.:||.:   |:|...|  
  Fly   143 GDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRD---GNLLAISPGGVYEAQF---GDHYYELLW 201

Human   210 QKRKGFVRLALRHGASLVPVYS------FGENDIFR 239
            :.|.||.::|:...|.::|.::      |.:..|||
  Fly   202 RNRVGFAKVAIEAKAPIIPCFTQNLREGFRQVGIFR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MOGAT3XP_005250366.1 LPLAT 45..290 CDD:327403 55/216 (25%)
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 53/213 (25%)
LPLAT_MGAT-like 90..298 CDD:153249 41/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.