DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp33Ea and AT5G65687

DIOPT Version :9

Sequence 1:NP_001260417.1 Gene:Oatp33Ea / 34660 FlyBaseID:FBgn0032433 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_680469.1 Gene:AT5G65687 / 836697 AraportID:AT5G65687 Length:492 Species:Arabidopsis thaliana


Alignment Length:304 Identity:65/304 - (21%)
Similarity:112/304 - (36%) Gaps:84/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FSYVPLVLIFLSQFVLGVGNTLYYSLGQTYLDDNTKKTNTPLMLAVAMALRMIGPVVGFFFGFIS 242
            |||...::.....|| |||...:.||...|:||:.........|.:.......|..:|:.||   
plant   129 FSYNFWMIAVFRMFV-GVGEASFISLAAPYIDDSAPVARKNFWLGLFYMCIPAGVALGYVFG--- 189

  Fly   243 LNTFIDPTKTPLIDSKDPRWLG---AWWLGWVILGTLMCLFSGLIGLF----PKQLPKVNASRTN 300
                              .::|   .|...:.|....|.:|  :|..|    |:||.        
plant   190 ------------------GYIGNHLGWRWAFYIEAIAMAVF--VILSFCIKPPQQLK-------- 226

  Fly   301 SHLPLALRQTKEELKREENLSLSSRFSSNAALDTIGAAAGANADLPKLKD----FPRALMRLLRN 361
               ..|.:.:|:.....|.::           .|...|:......||.|:    |.:.|..|...
plant   227 ---GFADKDSKKPSTSIETVA-----------PTDAEASQIKTKTPKSKNLVVLFGKDLKALFSE 277

  Fly   362 KLLIFNILSAVFY--ILGA-------SGFMTFLTKYMEVQFHKDAQSATIIVGPISIMGMVVGLI 417
            |:.|.|:|..:.|  ::||       :||..:..|           :|.:|.|.::|:..::|.:
plant   278 KVFIVNVLGYITYNFVIGAYSYWGPKAGFGIYKMK-----------NADMIFGGLTIICGIIGTL 331

  Fly   418 GSGMVLSKKKPSVS---KVLMWNVIVGG----ISILGQISYAFL 454
            |...||.:...::|   |:|..:.::|.    .:.|.:..|||:
plant   332 GGSYVLDRINATLSNTFKLLAASTLLGAAFCFTAFLMKNMYAFI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oatp33EaNP_001260417.1 OATP 36..684 CDD:281175 65/304 (21%)
MFS 40..>280 CDD:119392 22/104 (21%)
DUF4064 364..447 CDD:290013 21/98 (21%)
KAZAL_SLC21 470..521 CDD:238650
AT5G65687NP_680469.1 MFS 30..458 CDD:119392 65/304 (21%)
MFS_1 71..418 CDD:284993 65/304 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.