Sequence 1: | NP_001260417.1 | Gene: | Oatp33Ea / 34660 | FlyBaseID: | FBgn0032433 | Length: | 745 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286710.1 | Gene: | CG30278 / 246523 | FlyBaseID: | FBgn0050278 | Length: | 275 | Species: | Drosophila melanogaster |
Alignment Length: | 111 | Identity: | 26/111 - (23%) |
---|---|---|---|
Similarity: | 43/111 - (38%) | Gaps: | 19/111 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 499 SACHAGCRGY-------NATSKLYED-CS-CV---VNDPA---PKSAAQRLLNLLQPTPEPELDT 548
Fly 549 TTYFDEYLSGVPLLDDNGDFDDQLLSRTRRSTSDSVIRPGICTKNC 594 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Oatp33Ea | NP_001260417.1 | OATP | 36..684 | CDD:281175 | 26/111 (23%) |
MFS | 40..>280 | CDD:119392 | |||
DUF4064 | 364..447 | CDD:290013 | |||
KAZAL_SLC21 | 470..521 | CDD:238650 | 7/30 (23%) | ||
CG30278 | NP_001286710.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3626 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |