DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp33Ea and CG30278

DIOPT Version :9

Sequence 1:NP_001260417.1 Gene:Oatp33Ea / 34660 FlyBaseID:FBgn0032433 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster


Alignment Length:111 Identity:26/111 - (23%)
Similarity:43/111 - (38%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 SACHAGCRGY-------NATSKLYED-CS-CV---VNDPA---PKSAAQRLLNLLQPTPEPELDT 548
            ||....||.:       ....|.:|. |. |:   |:.||   |:..|:.:..:::| ..|....
  Fly     2 SAPENSCRRWIKKNWVDGPCKKCFESTCGPCIDYRVSPPAADLPEPQAEVVKAVIEP-DGPVRQE 65

  Fly   549 TTYFDEYLSGVPLLDDNGDFDDQLLSRTRRSTSDSVIRPGICTKNC 594
            .....|...|.|||:.:   .|:|...|.....:..:.|.:|:..|
  Fly    66 INIRAECSKGRPLLESD---KDKLRCCTMCVAQEQNLHPNLCSAQC 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oatp33EaNP_001260417.1 OATP 36..684 CDD:281175 26/111 (23%)
MFS 40..>280 CDD:119392
DUF4064 364..447 CDD:290013
KAZAL_SLC21 470..521 CDD:238650 7/30 (23%)
CG30278NP_001286710.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.