DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp33Ea and slco2a1

DIOPT Version :9

Sequence 1:NP_001260417.1 Gene:Oatp33Ea / 34660 FlyBaseID:FBgn0032433 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001083051.1 Gene:slco2a1 / 100038802 ZFINID:ZDB-GENE-060606-3 Length:221 Species:Danio rerio


Alignment Length:281 Identity:67/281 - (23%)
Similarity:110/281 - (39%) Gaps:81/281 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVKRRDPNRPPGHYLCGMANWHPPWLQKYATTKMFMGVYGLLGTIQAMSYMYFIVTLTTLEKRFK 67
            ::..:|..:|.....|.:              |:|:..:|||...|.:...||..|:||:|:|:.
Zfish     2 DIYAKDIKKPKPSLFCNI--------------KIFVLCHGLLQLTQLLYSSYFKSTITTIERRYG 52

  Fly    68 IPSQTTGIILSGNEISQIMLSLILSYIGGQRNRPRWIAWGIVFCGLSCYILVLPHFI-----YGA 127
            :.|.::|.|.|.:|:...:|...:||:|.:.:|||:|..|.:...:|..||.||||:     |.:
Zfish    53 LDSLSSGTISSLHEVGNTVLKAFVSYLGSRVHRPRFIGLGGLLMSISAMILALPHFLSQPYTYDS 117

  Fly   128 GHEVLQFTKEYQDSLLNGTTGSDHSFQNISSVKTERLCGVDKTEDDCDDLFSYVPL-VLIFLSQF 191
               ||..:::....|....||::             .||    ::|...|...... ||:..:| 
Zfish   118 ---VLHASRQDMCYLRANVTGAE-------------ACG----QEDSRKLMDTSKFWVLMATAQ- 161

  Fly   192 VLGVGNTLYYSLGQTYLDDNTKKTNTPLMLAVAMALRMIGPVVGFFFGFISL---NTFIDPTKTP 253
                           ||...|...||.|            .|.|...|::|.   ||..:...| 
Zfish   162 ---------------YLSSVTLSINTWL------------EVQGIHSGYVSCCRQNTCFEYLFT- 198

  Fly   254 LIDSKDPRW-------LGAWW 267
              .:..|.|       |.:|:
Zfish   199 --SAHQPTWTDSGTFHLHSWY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oatp33EaNP_001260417.1 OATP 36..684 CDD:281175 63/248 (25%)
MFS 40..>280 CDD:119392 62/244 (25%)
DUF4064 364..447 CDD:290013
KAZAL_SLC21 470..521 CDD:238650
slco2a1NP_001083051.1 OATP 21..>110 CDD:281175 33/88 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.